PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 904197
Common NameARALYDRAFT_904197
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 442aa    MW: 49835.6 Da    PI: 9.7385
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
904197genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.4e-07129171346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE ++l + ++ +  + +  Ia +++  Rt +++k+r+++
           904197 129 VWTKEETDQLFEFCQNFDLR-FVVIADRFPVSRTVEELKDRYYS 171
                      6*******************.*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162826.4E-30102176IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007179.5E-9126175IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-6126177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-6129172IPR009057Homeodomain-like
CDDcd116582.79E-19130173No hitNo description
PfamPF054992.6E-7319386IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MGGTDAKDIL GLPKTPLSLT QEKKSRPQKE SHRKPDGISR EVYALTGGVA PLMPSIDLKR  60
RPPPDEKVAW KWLSFTNSAR KDDLQLYHWV RVVNDVPPTG DYSFAKYNKS VDILKYTDEE  120
YENHLTDPVW TKEETDQLFE FCQNFDLRFV VIADRFPVSR TVEELKDRYY SVNRALLRAR  180
AQSPADVANH PLMKEPYDIT RDRERKRALS MVLSQSRHQE KKDAEILAEA KRITEMRLAA  240
RRAEEPDVSA NENAGLDKAD GVVPGRSVSP TSNSQLPATA VAPSTLTMAD YASTLASLRM  300
LHVYLRTYGL EQMVQAASSA VGLRTIKRVE QTLQDLGVNL KPKVPTKTVC DEHLELRKEI  360
LTLLNLQKQL QYKESEGSSH REGSYAAMPD TPKDRVFASD PFSFGAERPI KKDQKRKGPG  420
RQADTPSPAH KRPRKLKASD L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4iej_A1e-18101181488DNA methyltransferase 1-associated protein 1
3hm5_A1e-18101181488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935950.0AB493595.1 Arabidopsis thaliana At2g47210 mRNA for hypothetical protein, partial cds, clone: RAAt2g47210.
GenBankAY0640240.0AY064024.1 Arabidopsis thaliana unknown protein (At2g47210) mRNA, complete cds.
GenBankAY0966100.0AY096610.1 Arabidopsis thaliana unknown protein (At2g47210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880287.10.0myb family transcription factor
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLD7LG020.0D7LG02_ARALL; Myb family transcription factor
STRINGscaffold_403698.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85432435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein